NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164242_10781794

Scaffold Ga0164242_10781794


Overview

Basic Information
Taxon OID3300012942 Open in IMG/M
Scaffold IDGa0164242_10781794 Open in IMG/M
Source Dataset NameMiracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)657
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location NameUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0164242_107817941F034190N/ANRIILDAFSELLGKQHVEQALKAVTTVHSAGCGGKSDLYDLNGPEIRKWLKKNCCSTLLAAATRAGSVTAACKTTFSVLKGWLQQLHDCLLHKDEWERDDIEAWRSVVDDIWQHWCAEAKSVPFPKLHMLRHAVDFAERHRFLGRASEAQIESFHAQFNALFHRQHRNQSGNTGERLRRSLADATLRAVQPCLSRPTSAASTSS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.