Scaffold Ga0153798_10200538

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153798_10200538

Scaffold Ga0153798_10200538

Overview

Basic Information
Taxon OID	3300012949 Open in IMG/M
Scaffold ID	Ga0153798_10200538 Open in IMG/M
Source Dataset Name	Switchgrass enrichment cultures co-assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	720
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location Name	USA: Dartmouth College, New Hampshire
Coordinates	Lat. (^o)	43.726	Long. (^o)	-72.1429	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013855	Metagenome / Metatranscriptome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153798_102005381	F013855	N/A	MHPNTMKRNKRVWGPMGSIGCVRCENIRRDFVALTFALIAPVRPILHRVYCHYKMLPNAPKHYETHHNMSLGSDAVDWADLLQRILLQLCGLNFWFNCNSSAFEPSIVKQQNGPKCTQTLGNKTKHDFRFQWGWISCIRYEKFGHDFVA*TFALIAPVQPILHR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.