NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163180_10014971

Scaffold Ga0163180_10014971


Overview

Basic Information
Taxon OID3300012952 Open in IMG/M
Scaffold IDGa0163180_10014971 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4374
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameNorth Atlantic Ocean
CoordinatesLat. (o)26.049Long. (o)-17.4585Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017147Metagenome / Metatranscriptome242N
F018943Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0163180_100149712F017147N/AMENFKNFYKFKGGLAVTNMLYEPLVSNDKKIFCMNWNVNEYFDNAEMTEELYNFWFNQECKYLLHLSNKKYIPEILLIDTKKRIIEFKWYGKNLNVMIENNTINKVKNWQKKIKAIKDDLEKDSIFKINMYPHTFFFDDDGNAHIMDLYGCTDKNTRYLDTKYLKPLIRTDRFDKFIVNDQLDTHELYNETIKTNYAEWPGDFLNA*
Ga0163180_100149718F018943AGGMDGKMKIIITGHTSPMGNAVYDYYKQKHEVLGVSKNEGFDFTKNHHQDQIVDMALARDVFLNIAHVGTAQSTIMMKLKQRWSPEAPLRKVITVGSLATKVDEKLLEQVNIDKQYLKDKQHIDAVSNMMSNEKPFGEQLHYTLVRVLNYGEKTGDRAGEPTCSVDDICRTFDYIINEPMYIGKLDIRRN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.