NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0154020_10177452

Scaffold Ga0154020_10177452


Overview

Basic Information
Taxon OID3300012956 Open in IMG/M
Scaffold IDGa0154020_10177452 Open in IMG/M
Source Dataset NameActive sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1988
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location
Location NameAustria: Klosterneuburg
CoordinatesLat. (o)48.3Long. (o)16.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038201Metagenome / Metatranscriptome166N
F045645Metagenome152N

Sequences

Protein IDFamilyRBSSequence
Ga0154020_101774522F038201N/AMDVFTRNVQFMVSQVAGEHAGQTFQMLQRTFPGLRNFEQLRTFAKLYVNNGLNPLQLRPLPSDVDPHGLKGELALRFCGGIIVLAKDERIVCRGAEAYGPFDPIQAASFSRKLSAESPTNDDRGHALDPEQCVPSPVGVYPEIA*
Ga0154020_101774523F045645AGGMKLQETALRMLKSVAGVFHVRPIIPDRALTLRKGRRGHELIQNEGEAVRVVAVGDDKPGLLSFAALNGIPVKNYTDMAVPKPETTNKDAAQVPELSM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.