Basic Information | |
---|---|
Taxon OID | 3300012957 Open in IMG/M |
Scaffold ID | Ga0164303_10232926 Open in IMG/M |
Source Dataset Name | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1043 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Mt. Pleasant research farm, Cornell University, New York | |||||||
Coordinates | Lat. (o) | 42.4531 | Long. (o) | -76.3842 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006194 | Metagenome / Metatranscriptome | 379 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164303_102329262 | F006194 | N/A | HVPRMNGRPRRNAESKSKPSTQRRARNAQSKAQINLAKALATVFAAGVYNKEELQAAVCTFVAQMKEGGETGEEVVRAAQGLVRDVGARFPSSERTQVLLADMVTWCLAEYYRESA* |
⦗Top⦘ |