NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164301_10743636

Scaffold Ga0164301_10743636


Overview

Basic Information
Taxon OID3300012960 Open in IMG/M
Scaffold IDGa0164301_10743636 Open in IMG/M
Source Dataset NameUnamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)743
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Mt. Pleasant research farm, Cornell University, New York
CoordinatesLat. (o)42.4531Long. (o)-76.3842Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021388Metagenome / Metatranscriptome219N

Sequences

Protein IDFamilyRBSSequence
Ga0164301_107436361F021388GAGMRIKRAPNDAGTKLTIEFTYYDNGSVSINGSAKGDHTPDEAERWLASTRFVMQMIEEFRNYINKSKTSAAALSASEAPGRRRLRSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.