Scaffold Ga0168317_1013039

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168317_1013039

Scaffold Ga0168317_1013039

Overview

Basic Information
Taxon OID	3300012982 Open in IMG/M
Scaffold ID	Ga0168317_1013039 Open in IMG/M
Source Dataset Name	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota - Twin Cities
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2630
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings → Weathered Mine Tailings Microbial Communities From Hibbing, Minnesota, Usa

Source Dataset Sampling Location
Location Name	Hibbing, MN, USA
Coordinates	Lat. (^o)	47.432362	Long. (^o)	-92.940835	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067309	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168317_10130392	F067309	GGA	MSHIIGRPDDDLLDVMLGHGNDPEQAFIGGSEQGLEEGDGFEDRVRADEPTVPEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.