Scaffold Ga0164307_10001388

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0164307_10001388

Scaffold Ga0164307_10001388

Overview

Basic Information
Taxon OID	3300012987 Open in IMG/M
Scaffold ID	Ga0164307_10001388 Open in IMG/M
Source Dataset Name	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10934
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: Mt. Pleasant research farm, Cornell University, New York
Coordinates	Lat. (^o)	42.4531	Long. (^o)	-76.3842	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068088	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0164307_100013884	F068088	GGA	MNADGLQVEIVDGQITVTRPATNYAITYRKSADAPHLELAHSWIALGVTTPDVSEFRTQAFQVAVDKARELGWIV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.