Scaffold Ga0159060_1106742

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0159060_1106742

Scaffold Ga0159060_1106742

Overview

Basic Information
Taxon OID	3300012990 Open in IMG/M
Scaffold ID	Ga0159060_1106742 Open in IMG/M
Source Dataset Name	Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	764
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015

Source Dataset Sampling Location
Location Name	Canada: Alberta
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.55	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005480	Metagenome / Metatranscriptome	399	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0159060_11067422	F005480	AGGAG	MATTTPNFGWSVPTSTDLVKDGATAIETLGDSIDASLVDLKGGTTGQVL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.