NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157150_1070226

Scaffold Ga0157150_1070226


Overview

Basic Information
Taxon OID3300012992 Open in IMG/M
Scaffold IDGa0157150_1070226 Open in IMG/M
Source Dataset NamePig viral communities from ears skin of healthy adult pig - Individual 0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAutonomous University of Barcelona
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)660
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Skin → Unclassified → Unclassified → Pig Ears Skin → Pig Viral Communities From Oral Cavities And Ears Of Healthy Adults Pigs From Denmark

Source Dataset Sampling Location
Location NameDenmark
CoordinatesLat. (o)56.0Long. (o)10.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042737Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0157150_10702262F042737N/AMKLTEKSMEVYNYLKENGGRVSIEELAAGLNRTARSVNANVTDLCSEKKGLAMREKVKGEGEDAKDITYVVLTEAGKTFVPSED*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.