Basic Information | |
---|---|
Taxon OID | 3300013001 Open in IMG/M |
Scaffold ID | Ga0157365_10100091 Open in IMG/M |
Source Dataset Name | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 914 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: Ribeir?o Preto, State of S?o Paulo | |||||||
Coordinates | Lat. (o) | -21.167 | Long. (o) | -47.851 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013385 | Metagenome | 271 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157365_101000912 | F013385 | N/A | FRINHLLPMLVPLAPRLLLLVLVSLQTHSTLFLVPALGLVNTFIPEDALMLVALSDAPPGVSQLLRTLGKHLLSLLLPLRRRKVKRRRSVLVPEHLLPLGSLQVSSLTKLPLSLCS* |
⦗Top⦘ |