NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164294_10155236

Scaffold Ga0164294_10155236


Overview

Basic Information
Taxon OID3300013006 Open in IMG/M
Scaffold IDGa0164294_10155236 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1652
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001055Metagenome / Metatranscriptome791Y
F001725Metagenome / Metatranscriptome645Y

Sequences

Protein IDFamilyRBSSequence
Ga0164294_101552363F001725N/AMASVNKGTTCLYGVAGTVTNLFVQSYSISSSFNNEDMVQDESGLTKTCRYDDRKSEITVEGIVKVGSLPTLGASFSFTLNADSAYPSGTQSPSFAGWITKIDEKGGNKEFVKVSVTAVDYEGVAP*
Ga0164294_101552364F001055N/ASTETGLTGVSLYTGDSSEVMTLPKLVILCESARTPSDLPEGLGNYSCSVRMTLFSNADDTTLTDHRARCAGLTGAMSVDSLPGIKTAFTNSGDATCYDVTPQNEDEGIDERSWATVFTYDVLVVLPA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.