NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167616_1005119

Scaffold Ga0167616_1005119


Overview

Basic Information
Taxon OID3300013008 Open in IMG/M
Scaffold IDGa0167616_1005119 Open in IMG/M
Source Dataset NameExtremophilic microbial mat communities from Yellowstone National Park, USA - OSPB_Mat_host_9_15 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2681
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, USA
CoordinatesLat. (o)44.733Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065947Metagenome127Y
F099550Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0167616_10051193F065947GAGMKMLKLNRTFNPFRIFGVLRHHNNTNNLPCVAYGTGNLSRRIGRGYFFYDYDTSDEKEVERFRKYVQHTFYVAYVLFRTKHGVMVMTTLTFPYEQLRKYYDQFQANFPSDYLWDIPLFLRISEKWDWQTGKVLSPMPQIIDNPKKIDIYKLIHEDMYPKKWYRTSD*
Ga0167616_10051194F099550N/AMSGNVHTNGRREKLLASKRKNMQIVWVPLSVLDEIAQIAEKLHLALNQTIIVLAIRALRGFPQQTNNGSAHFLCPICLQSFTNSADFLAHLRGDENVEIKPHI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.