NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129327_10043006

Scaffold Ga0129327_10043006


Overview

Basic Information
Taxon OID3300013010 Open in IMG/M
Scaffold IDGa0129327_10043006 Open in IMG/M
Source Dataset NameFreshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2283
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)37.1043Long. (o)-76.1811Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063848Metagenome / Metatranscriptome129N
F085905Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0129327_100430062F085905N/AMEEQLSFPSSRLSQFDYVGMNAYWLNTRLRYFTDPMLYAVATGIWVINLMDDVDIAETGTEKNFEYGLIYVYSNSRIDSLFIVALTHYFNVKREREYYRSIPMDALQSVMKSLVDFMNDKLKILDKLKEKIDERVVLMMWNQLYIFVMGFLYGLYGRDAEAVFQGVMARYLLPYSVLEVIRRHLKK*
Ga0129327_100430063F063848N/AVAKKKRSVHDPTLSVIHYQEQLEKMSKAFEKSSTRRNQRAVNGFTVLKQVQNTVRDYLNEVSASMKAPVIAQLAVEFIGIAMAYLKGSNEGYNSYALTGRVAQIATLRATHIVHATTLTCAQVGEIINGMLKKLSGVTADPLTFTENDGVCEAKVANPLIKLSVASAGTGLTVALADIFKANTPEEVLMGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.