Scaffold Ga0169967_1000040

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169967_1000040

Scaffold Ga0169967_1000040

Overview

Basic Information
Taxon OID	3300013011 Open in IMG/M
Scaffold ID	Ga0169967_1000040 Open in IMG/M
Source Dataset Name	Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Johns Hopkins Bayview Research CORES
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	78337
Total Scaffold Genes	89 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	55 (61.80%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location
Location Name	Chile: Atacama Desert
Coordinates	Lat. (^o)	-20.43644	Long. (^o)	-69.58397	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067309	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169967_100004060	F067309	AGGA	MSPHIIGRPNDDLLDVILGPGADPEQAFIGGWEQGLEEGDGFEDHLLGDEPTVPEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.