NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170683_10117368

Scaffold Ga0170683_10117368


Overview

Basic Information
Taxon OID3300013027 Open in IMG/M
Scaffold IDGa0170683_10117368 Open in IMG/M
Source Dataset NameGypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Monturaqui
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJohns Hopkins Bayview Research CORES
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)692
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location
Location NameChile: Atacama Desert
CoordinatesLat. (o)-23.57431Long. (o)-68.10215Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019791Metagenome / Metatranscriptome227Y

Sequences

Protein IDFamilyRBSSequence
Ga0170683_101173682F019791AGGAGGMYWYNPTIHASERVAAPSNDDEAVRMLAGRPDSARLVSEYAELRRSGAPIERALVLVGHEERLREHELAPMRLAWRERPRRTRPSAEGYELLLAQRLREESGDRRKGRRSRAGA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.