Scaffold Ga0163212_1043258

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163212_1043258

Scaffold Ga0163212_1043258

Overview

Basic Information
Taxon OID	3300013087 Open in IMG/M
Scaffold ID	Ga0163212_1043258 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1533
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Malawi: Central Region
Coordinates	Lat. (^o)	-13.5167	Long. (^o)	34.7703	Alt. (m)		Depth (m)	45
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084832	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163212_10432581	F084832	GGAG	MISDHAKPEDFDRWRSHAETCDLGSLRFIIRDCREVAQNLRGYNPVREGYYEDQAFTYADELARRLRLTRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.