NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163212_1047114

Scaffold Ga0163212_1047114


Overview

Basic Information
Taxon OID3300013087 Open in IMG/M
Scaffold IDGa0163212_1047114 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1459
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameMalawi: Central Region
CoordinatesLat. (o)-13.5167Long. (o)34.7703Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015080Metagenome / Metatranscriptome257Y
F048940Metagenome / Metatranscriptome147Y
F058096Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0163212_10471144F048940GAGMTAAQRMEKQFFIHFIQLIDEVQGKQKLPSQIQSHRKSSWVKKVSNPKKKKDALARI*
Ga0163212_10471145F015080N/AMFDLLQFQPHLNGISGAIAARHKFENDWSISVVAGPPNCGLHGNINENTYEVAIFRPNGNMTEDVSGWNNKEEVSAMMWVLSQL*
Ga0163212_10471146F058096N/AMNLSIDECKVMWVVGALQRLATLGLIGPDIPLKLTPDAVDDYIQIDEHRELLFESDFEIASIFTALADDECDPELQDPEDYKPIINLLVEYKDNRTEIVKYALSQQLV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.