Basic Information | |
---|---|
Taxon OID | 3300013087 Open in IMG/M |
Scaffold ID | Ga0163212_1079739 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1067 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Malawi: Central Region | |||||||
Coordinates | Lat. (o) | -13.5167 | Long. (o) | 34.7703 | Alt. (m) | Depth (m) | 45 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002302 | Metagenome | 573 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0163212_10797392 | F002302 | N/A | LNEALEDLATTLSAVSGLRCITDPTKIVPNCVFIQAPSFTTTFGNGNIVRIDFPIKIVGSGPAGLPVLREILQIASSVLGSSVVAMSGRPGLLEIGGQEFPSYDMTVGMQAQTA* |
⦗Top⦘ |