 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300013089 Open in IMG/M |
| Scaffold ID | Ga0163203_1032561 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1510 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 50.0621 | Long. (o) | -124.7214 | Alt. (m) | Depth (m) | 330 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038536 | Metagenome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0163203_10325612 | F038536 | GGAGG | VNLQILRRRAEMLDAVCTGLHPSAVISQLAEKYDISEKALWSDWLRREKWVPFLLELEKFADFSGMVVERLNGVQKAAWSIYLKASNDSARVGALRTVLEALEIHRDVIQTMDVLDRLDQLEEVAKERENGVKRGGGSLH* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |