NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163199_1029996

Scaffold Ga0163199_1029996


Overview

Basic Information
Taxon OID3300013092 Open in IMG/M
Scaffold IDGa0163199_1029996 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2622
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)50.0621Long. (o)-124.7214Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F006841Metagenome / Metatranscriptome363Y

Sequences

Protein IDFamilyRBSSequence
Ga0163199_10299962F006841AGGAGGLATTVYDVEEIELQSGAKVKLKPLSIKQLRKFMIVIKKVQDAEDETATLGILVEACGVALETQLPDLVADLDKLEEALDVPTINRILEVCGGIKMDDPNLIAAAVLAGQN*
Ga0163199_10299964F000258GAGGMPDYKLDAMFEIRKFLWVKLQAANIFNKDDYYAHNLDEAMIPIIPVQQQPEMNQFLSGMKHIVYDKIGMSYEDNWLICCEQILLTLYSPDFVDIVEMRNFLTDEFRRMDQSAGDVNKWAGLSNKFKFHSIYIADISSTAPSEEIQGFFASDVILEIKYSRITNTAGRFL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.