NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163199_1058745

Scaffold Ga0163199_1058745


Overview

Basic Information
Taxon OID3300013092 Open in IMG/M
Scaffold IDGa0163199_1058745 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1711
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)50.0621Long. (o)-124.7214Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001125Metagenome / Metatranscriptome769Y
F007470Metagenome / Metatranscriptome350Y
F045058Metagenome / Metatranscriptome153Y
F047650Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0163199_10587452F001125GGAGMGDRANFGFRDSRENVVFLYGHWAGHNMLAKLANAVQAAESRWQDDSYATRICISNLIGEDWTQTTGWGIYINQLGDNEHKVPVIDWKNQTFTLYEEDLSTVVFSTSLTSFVDKYSRLVMV*
Ga0163199_10587453F047650GGAGMNSEDINPIYYCDSCSVARASHLIKLLDGELSFCGHHYFKNKEALDKQSYETIQLNKAEEAIPQLTKAE*
Ga0163199_10587454F007470AGGAGMDYQDGFQDGVKFAREVIINNLRLWAETSDDGGVMDEIGDRIEFGVINYEL*
Ga0163199_10587455F045058N/AEMAYWDAQITGLDPTFMPPLTFNVGTGSIEKVSRIRDKYNLTESYVSEYETTGY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.