NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164296_1008558

Scaffold Ga0164296_1008558


Overview

Basic Information
Taxon OID3300013093 Open in IMG/M
Scaffold IDGa0164296_1008558 Open in IMG/M
Source Dataset NameDystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8117
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001059Metagenome / Metatranscriptome790Y
F001915Metagenome / Metatranscriptome617Y
F006264Metagenome / Metatranscriptome377Y
F012670Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0164296_100855814F001915AGGAMEWTLAHPLHDVEDIVSLADMNYGSEIDGILKRDRNVFRHRVTVATTEQIFNKSREFIAVCRQEQEIPLVNLQGDIVGRTTDYKLLGFCWFDRGGYTTYSNEEISNAKFHHIDLSLSPRTRVRLVNEMIDQHILWAHTYGIPIICSTSIRAEHNGFIKIHQKRGFTVNGSYAWIRTEEAMKCLTNQ*
Ga0164296_100855815F012670GAGGVFDQPIRPEGSDVSDEKKKEIARAAYRAKKAEKKALAIASGERQPRGGFAEGVITNPKGRPKSIVNRVTEYGALFNKLNEERVSKGLAPLKTAMEVLIDAMQSDELDIKDKARIADKLAPFESSRAPVISIEHVQNVSREEETDADEALDDFIESLRKV*
Ga0164296_100855819F001059AGGAMATYDIEALKADLPTAKELSQFVYDKTGIALDLVGKPKEDQYLAAKNALEGKKIPSEFLTDENPYVEKRDLVPEDPMPSVPPREAGLLDPEAMVHHFGATNMPHPLDPQSDRKVHITFRKYEDGSLTFEVVGPLEKQAKGSRLNKYGQVQPEKYTWLDPRTGERLMRKADGSFTKEGRGMYAYCVGEKGGGIWPLIDKEAVRISEKNIANPWA*
Ga0164296_100855820F006264N/AMEDFSAKFQQKLSGQAEVCARKTLEWLQKDLQGDKQLTPADVYYLSKAADVLLTIRDDYGKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.