NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172278_1063

Scaffold Ga0172278_1063


Overview

Basic Information
Taxon OID3300013121 Open in IMG/M
Scaffold IDGa0172278_1063 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from Jimei wastewater treatment plant (WWTP), Xiamen City, Fujian province, China
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)101483
Total Scaffold Genes68 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)39 (57.35%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Jimei Wastewater Treatment Plant (Wwtp), Xiamen City, Fujian Province, China

Source Dataset Sampling Location
Location NameJimei WWTP, Xiamen City, Fujian province
CoordinatesLat. (o)24.25Long. (o)117.57Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002465Metagenome / Metatranscriptome557Y
F006066Metagenome / Metatranscriptome382Y

Sequences

Protein IDFamilyRBSSequence
Ga0172278_106354F002465GGAGMPTSKPPKPDPNQELTERRIAEFAVEESRLSAVAYRFQLVPRERVWKNWDRTEFEPNHFQVVGLAGVCLNRDEIEKAERIASRALEEVDGILFTVEDPADSIVVRGVTGTMEFVRTPTLCAEIMAGSTGAFDRALAALGAAFPGDRVAGKIVSESK*
Ga0172278_106364F006066N/AMRRRPGEAPPTHRVWLSNEQPMREGPSPDGRQYFRIRFDNEPSPEWMRAYRAGLLGLMPEDRDAVLRFEFQGDSVRFVAADAEVAKLRRVLEQRVQAVNGILSGGRAVEP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.