Basic Information | |
---|---|
Taxon OID | 3300013121 Open in IMG/M |
Scaffold ID | Ga0172278_1294 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from Jimei wastewater treatment plant (WWTP), Xiamen City, Fujian province, China |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 124452 |
Total Scaffold Genes | 114 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 60 (52.63%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Jimei Wastewater Treatment Plant (Wwtp), Xiamen City, Fujian Province, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Jimei WWTP, Xiamen City, Fujian province | |||||||
Coordinates | Lat. (o) | 24.25 | Long. (o) | 117.57 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020435 | Metagenome | 224 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0172278_1294111 | F020435 | GGAGG | MTMTDLVSALSPAQYTELALGLFLAVYVAVVIRHGGKRRAAEHTACAQLPLADDAGELR* |
⦗Top⦘ |