NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172278_1298

Scaffold Ga0172278_1298


Overview

Basic Information
Taxon OID3300013121 Open in IMG/M
Scaffold IDGa0172278_1298 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from Jimei wastewater treatment plant (WWTP), Xiamen City, Fujian province, China
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)134440
Total Scaffold Genes159 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (16.98%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Jimei Wastewater Treatment Plant (Wwtp), Xiamen City, Fujian Province, China

Source Dataset Sampling Location
Location NameJimei WWTP, Xiamen City, Fujian province
CoordinatesLat. (o)24.25Long. (o)117.57Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044437Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0172278_129864F044437N/AMNLKEKLILTSLCVGFFGDALLQLLVSQTTLGGTTGWGLKEYFKQHGRAESLTIAAGMMAIFYAIYLYVLHLPLTWYYLAAYGIVLDLLFRQFMIFPSLKGYYAHLNYFWSAFWGAIPILLVYWIAKRWEDSE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.