NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172367_10038764

Scaffold Ga0172367_10038764


Overview

Basic Information
Taxon OID3300013126 Open in IMG/M
Scaffold IDGa0172367_10038764 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)3993
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (20.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameDemocratic Republic of the Congo: South-Kivu
CoordinatesLat. (o)-1.64Long. (o)29.05Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000785Metagenome / Metatranscriptome891Y
F009005Metagenome / Metatranscriptome324Y
F023789Metagenome / Metatranscriptome208Y
F093404Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0172367_100387645F023789N/AMDRVYSHNLTGRERIELQSKIQRLQWLLTECIGLEEYELCSQIKTLIQQKYELLTTNQTENEVE*
Ga0172367_100387647F000785N/AMRVSNKKLGMRFDCNKLWNWAHEKLGDSKCQAIAFYWKYSEGAEMGYYDWKNTIWINLAECKRMVTVQKTILHEWTHAQQSYRWWKHYDLNYGYKSNPYEIQARENEKLVKRAYKRRAK*
Ga0172367_100387648F093404N/AVHTNEEQNKPAIGQIAYNKCPHSTCELFENESGEYYPVCQKIETPGLIRSEYTPIGSRLQYPTKWGRRKAATHLLEFKIEDAKKQIMDAQSELEKLQRCLSDVQSWDDDSKD*
Ga0172367_100387649F009005N/AMLQLTESEMLQKARSIGMDEELLSYAKQIQRQLSGDGDIADWLDCLEMAYNELILNEL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.