Scaffold Ga0172363

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172363_10017819

Overview

Basic Information
Taxon OID	3300013130 Open in IMG/M
Scaffold ID	Ga0172363_10017819 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	5489
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location Name	Rwanda: Western Province, Lake Kivu
Coordinates	Lat. (^o)	-2.05	Long. (^o)	29.2062	Alt. (m)	Depth (m)	388
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034747	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172363_100178199	F034747	N/A	MSRNVYRVIRIITAKNPTFNMSYDEELVSILEESANIFDSLNSYGNGIFDILEDEFKEVKEKIEELIDGLESTKTNKPENKEKAKCYRKVLAEMERVIKKEGYISYQIY*

⦗Top⦘

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.