Scaffold Ga0172363_10958644

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172363_10958644

Scaffold Ga0172363_10958644

Overview

Basic Information
Taxon OID	3300013130 Open in IMG/M
Scaffold ID	Ga0172363_10958644 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	528
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location Name	Rwanda: Western Province, Lake Kivu
Coordinates	Lat. (^o)	-2.05	Long. (^o)	29.2062	Alt. (m)		Depth (m)	388
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013523	Metagenome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172363_109586441	F013523	N/A	IIDMSGTQVNRDTTSPFGVTDRIILEKYGFTIVNNRKSNPLVVDTNNTVNAFINRNGLIVKKDDKFLLEALTTYHFEDGSRKRLVKYTEQKYAHIDGLGDALRYGIHHLFPLQHDDMNIKEYVGMDQRYARMNRPGLQHMPDSPLYPGGPSWDDIINGNETNEDYMTY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.