NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172421_101522

Scaffold Ga0172421_101522


Overview

Basic Information
Taxon OID3300013212 Open in IMG/M
Scaffold IDGa0172421_101522 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Saiful Muluk Lake, Pakistan
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBGI Tech Solutions Co., Ltd.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7378
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Saiful Muluk Lake, Pakistan

Source Dataset Sampling Location
Location NameSaiful Muluk Lake, Naran, Pakistan
CoordinatesLat. (o)34.8762Long. (o)73.6934Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065785Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0172421_1015223F065785AGGAMDIKLSCIECNRPNVVPYGRGHRICGICSQRELKRERRKQTQRRIQTLGGFVLVVGAVWFSCLVASDWDTPNSPDHRAHQAMQARD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.