NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170573_10928331

Scaffold Ga0170573_10928331


Overview

Basic Information
Taxon OID3300013232 Open in IMG/M
Scaffold IDGa0170573_10928331 Open in IMG/M
Source Dataset NameSediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Davis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1064
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location
Location NamePittsburgh
CoordinatesLat. (o)40.44Long. (o)-79.99Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019851Metagenome227N

Sequences

Protein IDFamilyRBSSequence
Ga0170573_109283312F019851AGGMKRPDQVCESCWRVSRASSVPVTELACHHNKVLATWHADKEEWTYQHRVARKRPTQKQSEQLAQMFDQASSATRRRDDT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.