Scaffold Ga0170573_11247434

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170573_11247434

Scaffold Ga0170573_11247434

Overview

Basic Information
Taxon OID	3300013232 Open in IMG/M
Scaffold ID	Ga0170573_11247434 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Davis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10087
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location
Location Name	Pittsburgh
Coordinates	Lat. (^o)	40.44	Long. (^o)	-79.99	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000982	Metagenome / Metatranscriptome	814	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170573_112474349	F000982	GGA	LLVHHRLLGRAYPTLPYWERLHLMLLEEAEKRGKTPPPAPLVHGLESEPTKADRMERLDEQVAWADRNQLLHRIQMFFDAMPGSGWVETDK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.