Basic Information | |
---|---|
Taxon OID | 3300013280 Open in IMG/M |
Scaffold ID | Ga0119915_101807 Open in IMG/M |
Source Dataset Name | Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90903 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | California Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1676 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Australia: Queensland | |||||||
Coordinates | Lat. (o) | -27.49999 | Long. (o) | 153.01209 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078533 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119915_1018075 | F078533 | GGCGG | MTPAEFKRARETLCLSQNDLAEVWGMGDNGGRTIRRGERGGRPLTPTPRG |
⦗Top⦘ |