Scaffold Ga0136641_1020999

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136641_1020999

Scaffold Ga0136641_1020999

Overview

Basic Information
Taxon OID	3300013286 Open in IMG/M
Scaffold ID	Ga0136641_1020999 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2021
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location
Location Name	USA: Elizabeth Lake, Yosemite National Park, California, USA
Coordinates	Lat. (^o)	37.8453	Long. (^o)	-119.3697	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010984	Metagenome	296	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136641_10209991	F010984	N/A	VDPFTLLLAAQTAVGFIKQGCNLLHEGRMELEGAKKTAEQVIGDAKAIKGIFDWFIGLFVSKPTKADKPAEAKPVAKAKAKATKQQQSYEELELKLISEIGANIGVLFDTQQQITNCYLELEETSKTNYDPTQNTSKKAIERALIELQLEKLMEQTREAMVYAPPELKDLYSRFLKMHAKIEQEQAWARSELIRRNRLARWKQEQAEIELIGLISSGVAVVFISMFFGWMMWALRNLSGGF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.