Scaffold Ga0119913_100633

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119913_100633

Scaffold Ga0119913_100633

Overview

Basic Information
Taxon OID	3300013288 Open in IMG/M
Scaffold ID	Ga0119913_100633 Open in IMG/M
Source Dataset Name	Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90709
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	California Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2196
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Source Dataset Sampling Location
Location Name	Australia: Queensland
Coordinates	Lat. (^o)	-27.49999	Long. (^o)	153.01209	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100051	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119913_1006334	F100051	AGGA	MLERLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVSGAGTASAGLPG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.