NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157372_10013841

Scaffold Ga0157372_10013841


Overview

Basic Information
Taxon OID3300013307 Open in IMG/M
Scaffold IDGa0157372_10013841 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8615
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001131Metagenome / Metatranscriptome768Y
F034087Metagenome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0157372_100138411F034087N/AMTMKSWVLHRVSGLGGVAGRGDLPPRERGHEPDLDADAMARDHGGATSDALRPGADLGVYAPLITAVRDELEHFVVSHVRLHVTIADRDRFLLTSVGVRSPGGAQARELLQQFMHEFKPEQVKRYLAREVIGRLPNAGVID
Ga0157372_100138412F001131GGAGGMTAVARRNARHARGDASEVLPPPLVWTFDGPFERCLNDLEDSLRRALVLIGDVSRVALLIDVSLPALQARVRAGDRIQPAWGRFVERLSGYGLPAFPHVRPLRTPGPLATLVVAYRS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.