Scaffold Ga0175859_1145852

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0175859_1145852

Scaffold Ga0175859_1145852

Overview

Basic Information
Taxon OID	3300013314 Open in IMG/M
Scaffold ID	Ga0175859_1145852 Open in IMG/M
Source Dataset Name	Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Colorado
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2324
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated → Moss Microbial Communities From Three Moss Species From Boreal Forest In Fairbanks, Ak, Usa

Source Dataset Sampling Location
Location Name	USA: Fairbanks, AK
Coordinates	Lat. (^o)	64.8591667	Long. (^o)	-147.8247222	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012659	Metagenome / Metatranscriptome	278	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0175859_11458523	F012659	GAG	MQKQSDEKLLEVLTEIRNWIRAAAHGPVKNLLEAALPDAKSRAAYQMFDGTVSVEQVRVACKMSPNAVVALANRCTAMGLMGLNAEKKRLRLFDLTDFGLTAEQKD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.