NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120188_1005953

Scaffold Ga0120188_1005953


Overview

Basic Information
Taxon OID3300013760 Open in IMG/M
Scaffold IDGa0120188_1005953 Open in IMG/M
Source Dataset NameTerrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)981
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location
Location NameUSA: Kessler Farm Field Laboratory (KFFL), Okalahoma
CoordinatesLat. (o)34.975667Long. (o)-97.519Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016445Metagenome247Y
F046443Metagenome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0120188_10059531F046443GAGMKRIGKQFGSTSAVRREETVVKNFHQYVGPGGQILHGYVRRYKNIRLRKKGFTSKAEAERHLRQAMNDIDAEERGEIRCKPTTAQEALNIYRRNQEVRARDKGYQYAHNVRSNCKIIQQFVDHFGPNRLIRECTETDLREFYQILCFRPTLNKNSAGVFISRIQGMLKAAQKARPDLINWLRPTLKVNRTPEFEHRVVELTEYATLVQTLLNPPLAPSRRTERNK
Ga0120188_10059532F016445N/AMSLMTKKTRIDARRVAEIIGCSRKTVLNGGAGTAQLTRIRNGSTQVRFILEEVLAFAERQERDAQRRLPKGHSTMTS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.