NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119887_1069160

Scaffold Ga0119887_1069160


Overview

Basic Information
Taxon OID3300013769 Open in IMG/M
Scaffold IDGa0119887_1069160 Open in IMG/M
Source Dataset NameSewage treatment plant microbial communities from Vermont, USA - Sand_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwich University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1006
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location NameUSA: Vermont
CoordinatesLat. (o)43.727094Long. (o)-72.425964Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007038Metagenome / Metatranscriptome359Y

Sequences

Protein IDFamilyRBSSequence
Ga0119887_10691602F007038GAGGMTRRIFLDTEWTKAPWSQQSALMWIGLADEAGRSWYGISSEVDIDPATNDFISGVFRLITPDEPRLTNAEIAVAVIDFCGDVDEFWAWIPTLESFAAWSGLGDAAAALYAKHWDVDLQMVRSLVQPWPSGWPNRLLDLNTAAVEAGVAVPPRAVNHLHPRVHAEWNRDLFQLIRRSRKR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.