NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116699_1062438

Scaffold Ga0116699_1062438


Overview

Basic Information
Taxon OID3300013948 Open in IMG/M
Scaffold IDGa0116699_1062438 Open in IMG/M
Source Dataset NameCoral microbial communities from a home aquarium in Belgium - AM-T0-control A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Mons
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)597
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France

Source Dataset Sampling Location
Location NameBelgium: Mons, Walloon Region
CoordinatesLat. (o)50.45Long. (o)3.93Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062344Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
Ga0116699_10624381F062344N/APTSKISAQEIRHQFFLIWSNLKIMAHIMGFGNQSESWKNIILS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.