Scaffold Ga0119816_1041455

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119816_1041455

Scaffold Ga0119816_1041455

Overview

Basic Information
Taxon OID	3300014037 Open in IMG/M
Scaffold ID	Ga0119816_1041455 Open in IMG/M
Source Dataset Name	Human oral microbial communities from Los Angeles, CA, USA - S21-04-R
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Los Angeles
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1007
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location Name	USA: Los Angeles
Coordinates	Lat. (^o)	34.0722	Long. (^o)	-118.4441	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103436	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119816_10414551	F103436	AGG	MVTSKDGFCDKSDAEILESLKAWVMKCDVKYVKSDALKKIDSAFALWANAQYVSALRLLDENEVFLKKSDWPYYALGIQILKVRKHEFF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.