NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120381_1002328

Scaffold Ga0120381_1002328


Overview

Basic Information
Taxon OID3300014047 Open in IMG/M
Scaffold IDGa0120381_1002328 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1003
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Missouri
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6339
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)41.314168Long. (o)-105.584589Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053097Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0120381_100232815F053097N/AMFDIIGDKIKLNTEDLSIPPFKDHYNEATDKSAALKEIEYVIWLYKWNTPYEAYPADKRAQVVAKDVFKDENYKPTPAVEALAKRFKEF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.