NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119952_1028081

Scaffold Ga0119952_1028081


Overview

Basic Information
Taxon OID3300014050 Open in IMG/M
Scaffold IDGa0119952_1028081 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1759
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.21Long. (o)-83.96Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002398Metagenome / Metatranscriptome563Y
F009266Metagenome / Metatranscriptome320Y
F101144Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0119952_10280811F002398AGGAMIPLISIFLLTSLDPIKNFVSLKTYISENAKIHCHVYFINEDIPDYPRVNVIEKNKFDFFAYLDTIGVEHSQVGSYYFFYRKPK*
Ga0119952_10280812F009266AGGAMTNKERKILDKEIQYLCEQQDRVKAIREYTNINPHYTFLKEVETIEGLYKWVLENRKKEESTYFSCGTSGWYVVYLRDKKKYKKGEDFRIKIFHTFVWTDNLE*
Ga0119952_10280813F101144N/AMEAKTFTYYMTERHGYVETTRAYLRKLKISKLISPYSRQSGNKVYIEEDGDLSLFCKRHTVAGISIILKEEEKPQSFFDNMWNYRDDECQDEQFDGFKSEWSLSQRIHFIKPDSIKHLRNSTFETKDGKCLKIVPTFYLDGKPLNETQLKKLGIELTTTTTGELDYEYEL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.