NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119878_1143668

Scaffold Ga0119878_1143668


Overview

Basic Information
Taxon OID3300014055 Open in IMG/M
Scaffold IDGa0119878_1143668 Open in IMG/M
Source Dataset NameSewage treatment plant microbial communities from Vermont, USA - ANOX_W
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwich University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)632
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location NameUSA: Vermont
CoordinatesLat. (o)43.727094Long. (o)-72.425964Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050165Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0119878_11436681F050165N/AAVAGQVEHLDLVLVLTFWIVSEYRPMNPTIERALGASTPALRCLAVLDAMLVPALGLYWIKTLPATGGLVGAVLGVFCLWIGARRAYRALYEFEAYRWLTLRLAKLAIATWVVMAMVKLVWFIQGSL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.