Scaffold Ga0119868_1014423

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119868_1014423

Scaffold Ga0119868_1014423

Overview

Basic Information
Taxon OID	3300014059 Open in IMG/M
Scaffold ID	Ga0119868_1014423 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Membrane foulants
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Tongji University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2597
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location Name	China: Quyang, Shanghai
Coordinates	Lat. (^o)	31.3	Long. (^o)	121.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024268	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119868_10144235	F024268	GGA	MAIAELYSGTEAISTTEHSFTTDTSGPDVDTTDGIFQLWLDLSDMVAGDELQIRIYEKCRSGDTQRIVYQCSLFGAQADPIWVSPSLILMNGWDMTGDAISGTITVLWSIRQVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.