Scaffold Ga0180440_104293

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180440_104293

Scaffold Ga0180440_104293

Overview

Basic Information
Taxon OID	3300014147 Open in IMG/M
Scaffold ID	Ga0180440_104293 Open in IMG/M
Source Dataset Name	Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Washington, USA - P5_4mM MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4834
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Seattle, Washington
Coordinates	Lat. (^o)	47.6519	Long. (^o)	-122.3113	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043264	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180440_1042931	F043264	GAG	VSNGAGLTSATSVSTSAGLTSALANTAVGRIVLAPGNYMLSGQLGVTRSIVLEAAVAGSAVLDAQASSSSQRRVLNINPGPSGVVQLIGLNITGGYIQDPG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.