Scaffold Ga0181613_1036250

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181613_1036250

Scaffold Ga0181613_1036250

Overview

Basic Information
Taxon OID	3300014149 Open in IMG/M
Scaffold ID	Ga0181613_1036250 Open in IMG/M
Source Dataset Name	In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1385
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water → In Situ Water Column Microbial Community From The Vent Pool Of Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.7101	Long. (^o)	-110.7413	Alt. (m)		Depth (m)	.05 to .1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015737	Metagenome / Metatranscriptome	252	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0181613_10362503	F015737	N/A	MLLGQLYYYNKLLNSLSFPLTKEQLLHLELAGTPKLELNSLYHLSLNDLIRKLKDLFSYHYGQLLEQESLAFATQFWSNLVSATIPTEKTKLQPKTAFQQTLLSWQEKQFTIELIPEILKEGELTVDLEDFALFYGIKVLAILNQDILNTQLGSTEWQLPETTTTPGSLSTKPNILALTSEVYAPLFINLNCEYLPISEDLPELLKAVTQT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.