NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134081_10060242

Scaffold Ga0134081_10060242


Overview

Basic Information
Taxon OID3300014150 Open in IMG/M
Scaffold IDGa0134081_10060242 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1146
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000405Metagenome / Metatranscriptome1176Y
F005826Metagenome / Metatranscriptome389Y

Sequences

Protein IDFamilyRBSSequence
Ga0134081_100602421F005826AGGAGGMKGARSAQSRPYWVRYVVAFWAVEKLTWAKDNVVIACVCSLAPGLIAAGISAALSDDKWLAATYATLLTYGGLFGLFLTWRLIATPWELDRERQRFIDGLTQKLAYTRLELVALRASPPAIDVEILEIHVQAADTTHSMHASDLPVACDIFLRVKLTLRDTRPIGLLAYELASVLHGNSSRADFVDDIQ
Ga0134081_100602422F000405GGCGGMLGTAFSVKELVIAYYKVRIEDWNPAESDLEEIVQNTSTGEAICTKQEVVAVVDCPQDIDDDEAMSFFGGEEGDADQSQG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.