NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181531_10000011

Scaffold Ga0181531_10000011


Overview

Basic Information
Taxon OID3300014169 Open in IMG/M
Scaffold IDGa0181531_10000011 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)189926
Total Scaffold Genes169 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)115 (68.05%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018036Metagenome / Metatranscriptome237Y
F036336Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0181531_10000011152F018036GGAGMPEANDERCGKCGTDIDPTRRVDFTLKDGTRVCDSCFVKGTARPGNPDEKS*
Ga0181531_1000001125F036336GGAMWPAVFVLLATIGFSGCQMTSADGGTPAPAQPSATFSFCDKEASGCNGETSFSSTATRDLEVKISWENVPAGNHVQTLEILIPGGNLYQQTQMAFFVPQGSTEPLVAIQTLPVAGTWIQQRHMLGEWTTRVSLDGQVVATETVELTP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.