NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181526_10173296

Scaffold Ga0181526_10173296


Overview

Basic Information
Taxon OID3300014200 Open in IMG/M
Scaffold IDGa0181526_10173296 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1383
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).3 to .4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002261Metagenome / Metatranscriptome577Y
F069486Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0181526_101732963F002261GGAMPNWPGIEAFVDGVMLQTFGEPVVYQPVQAGVAHGNAFTVTAIRHLRVREESGAVANFEEISVNPSDFSNPPAKGDWVTAWGTQYVVTTVRQPDAYGMLNLALLQRS*
Ga0181526_101732964F069486N/AVINPKTILGEWVTALQSCPDLVTAIGGDGNNVRAFMEGLANDNNLRLAILQMPPGSILVAWNGTTPRRLTGGSLHFAHRFSLYLRAPEQDSTATYADLFWLLVSAKPTGAPSWESLLHLQIDPDCYPMDMDLPS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.